PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07460A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TALE
Protein Properties Length: 851aa    MW: 89612.7 Da    PI: 6.9299
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07460AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-096466831954
                                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Oropetium_20150105_07460A 646 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 683
                                664459******************************88 PP

2BELL90.41.8e-295235771872
                       BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 Vd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  Oropetium_20150105_07460A 523 HVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 577
                                69**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-52389575IPR006563POX domain
PfamPF075264.5E-50394574IPR006563POX domain
PROSITE profilePS5007112.568624687IPR001356Homeobox domain
SMARTSM003898.1E-10627691IPR001356Homeobox domain
CDDcd000863.65E-13627688No hitNo description
SuperFamilySSF466893.08E-17629694IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-29630693IPR009057Homeodomain-like
PfamPF059204.4E-18644683IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
METIESQGYA RRNKGGFLGW DSADDDDSGA AGMGIAAPPS QTTTTTYASQ PSKTTTAAAA  60
TISAGRPPAT ANSMSHSQDF HQGSFGFSSD GFDRPDSSSQ QDQQQHQSQL QHVAQQSRRE  120
KLRVQQQQQG GFDHRGHGQL LPIEGGDEHG EPGTAMYDHA AAAAGASNML SEMFNFPAQP  180
SGGGPSATEL LASQMTAASY RFGLRPGAGP GGVPGLSGAD GSSWFAAAGR GGLVLGGAGM  240
GGSLGETSSP KQQGGMAGIA ATDPAAAMQL FLMNPQQQQS RSSPTSPPPS DAQSTIQHHH  300
EAFQAXXXXX XXXXXXXAGV VEGQGLSLSL SPSLQQLEMA KQQAEELRVR DGVLYFXXXX  360
XXXXXXXPMA LHGQQIGGLA QQLHVGYGAG VAGVLRNSKY TRAAQELLEE FCSVGRGGQI  420
KGRGGGASSS NPNASNKQGG GGGASSSAAQ SPSSAASKEP PQLSPADRFE HQRKKAKLIS  480
MLDEARPLSH LLPRTRKFLS SSASLSLSLS LSCLHAWATT MMHVDRRYNH YCDQMQMVVN  540
FFDSVMGFGA ATPYTALAQK AMSRHFRCLK DAIAAQLRHT CELLGEKDAG TSSGITKGET  600
PRLRAIDQSL RQQRAFHHMG MMEQEAWRPQ RGLPERSVNI LRAWLFEHFL HPYPSDADKH  660
LLARQTGLSR NQVSNWFINA RVRLWKPMIE EMYQQECREL DGSSAGGGPE SGNDPSAADD  720
THSPTTTGAA QLPQQQLGGG GRHMMQEHGV AIPGMSAMPH KPDPGAAGPS SADAAFVGID  780
PVELLGGDGG GADDLYGRFE PGVRMRYGGP AATGATAGDV SLTLGLQHAG AGSAGPDGTG  840
RFSLRDYSGC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A6e-18633690158Homeobox protein Meis1
4xrs_B6e-18633690158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0645160.0BT064516.1 Zea mays full-length cDNA clone ZM_BFc0176J15 mRNA, complete cds.
GenBankEU9575010.0EU957501.1 Zea mays clone 1595427 homeodomain protein JUBEL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLF2CYW10.0F2CYW1_HORVD; Predicted protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-118BEL1-like homeodomain 4